HORDB

ID: hor004662
Uniprot ID: O24572
Protein name: CLAVATA3/ESR (CLE)-related protein ESR2-C
Gene name: ESR2C
Organism: Zea mays (Maize)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [ESR2Cp]: Expressed specifically in the embryo surrounding region at the micropylar end of the seed endosperm at early stages (4 to 7 days after pollination, DAP) and ever-decreasing parts of the suspensor at subsequent stages. |[ESR2Cp]: Seed endosperm.
Disease: NA
Comments: NA
Taxonomy: Zea (genus), Tripsacinae (subtribe), Andropogoneae (tribe), Andropogonodae, Panicoideae (subfamily), PACMAD clade, Poaceae (family), Poales (order), commelinids, Petrosaviidae (subclass), Liliopsida, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: TRTDDKPGVNRNMEMQQQQGGFIGHRPRLASFNRASKQLDREKRPVPSGPDPIHHSIPSHAPQHPPSYGKAPYEDDKSIASPGLSNLIGPPPFLDRY
Length: 97
Propeptide: TRTDDKPGVNRNMEMQQQQGGFIGHRPRLASFNRASKQLDREKRPVPSGPDPIHHSIPSHAPQHPPSYGKAPYEDDKSIASPGLSNLIGPPPFLDRY
Signal peptide: NA
Modification: T47 Hydroxyproline;T50 Hydroxyproline
Glycosylation: T50 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-O24572-F1.pdb

hor004662_AF2.pdb

hor004662_ESM.pdb

Mass:	1250251	Formula:	C472H734N146O142S2
Absent amino acids:	CW	Common amino acids:	P
pI:	10	Basic residues:	18
Polar residues:	26	Hydrophobic residues:	20
Hydrophobicity:	-113.51	Boman Index:	-26035
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	51.34
Instability Index:	4947.22	Extinction Coefficient cystines:	4470
Absorbance 280nm:	46.56